Quick Answer: What Word Is Similar To Acropolis?

Which word is similar to just?

Similar words for just:accurate (adjective)accurate, precise (adjective)admissible (adjective)all (adjective)appropriate (adjective)balanced (adjective)barely (adjective)befitting (adjective)More items….

How do you say Kingdom in other languages?

In other languages kingdomAmerican English: kingdom.Arabic: مَـْملَكَةٌBrazilian Portuguese: reinado.Chinese: 王国Croatian: kraljevstvo.Czech: královstvíDanish: kongerige.Dutch: koninkrijk.More items…

What is another word for mere?

What is another word for mere?baretriflingjustminimalonlypaltryscantscantyskimpytrivial27 more rows

What another word for could?

What is another word for could?wouldcancould perhapscould potentiallymight possiblymight potentiallypotentially willmay potentiallycould possiblymay actually4 more rows

What is a another word for Acropolis?

Words related to acropolis fortification, camp, station, fastness, castle, garrison, fortress, citadel, blockhouse, redoubt, stronghold, hold, palace, manor, seat, keep, peel, villa, mansion, tower.

Which word is similar to Kingdom?

Synonyms forcommonwealth.county.crown.domain.dynasty.empire.realm.sphere.

Which word is similar to synonym?

Synonyms forakin.analogous.comparable.complementary.identical.related.like.agnate.

Does Acropolis mean high city?

There are different translations of its name, but the word Acropolis basically means “high city.” “Almost every Greek city-state (or polis) had one, but no other acropolis was as successful as the Athenian,” Hurwit writes.

What is another word for overjoyed?

In this page you can discover 19 synonyms, antonyms, idiomatic expressions, and related words for overjoyed, like: enraptured, transported, thrilled, charmed, elated, happy, sorrowful, upset, disappointed, dejected and depressed.

What do you call a kingdom?

Kingdom Synonyms – WordHippo Thesaurus….What is another word for kingdom?provincerealmcountrydomainnationstateterritorylandareadominion38 more rows

Is the Acropolis the same as the Parthenon?

The Acropolis is the high hill in Athens that the Parthenon, an old temple, sits on. … Acropolis is the hill and the Parthenon is the ancient structure.

What happened to the Acropolis?

In 480 B.C., the Persians attacked again and burned, leveled and looted the Old Parthenon and almost every other structure at the Acropolis. To prevent further losses, the Athenians buried the remaining sculptures inside natural caves and built two new fortifications, one of the rock’s north side and one on its south.

What does acropolis mean in English?

: the upper fortified part of an ancient Greek city (such as Athens) also : a usually fortified height of a city or district elsewhere (as in Central America)

Who destroyed the Acropolis?

After the Ottoman conquest, it was turned into a mosque in the early 1460s. On 26 September 1687, an Ottoman ammunition dump inside the building was ignited by Venetian bombardment during a siege of the Acropolis. The resulting explosion severely damaged the Parthenon and its sculptures.